Lineage for d1y64b1 (1y64 B:1350-1760)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651099Fold a.207: Formin homology 2 domain (FH2 domain) [101446] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 651100Superfamily a.207.1: Formin homology 2 domain (FH2 domain) [101447] (1 family) (S)
  5. 651101Family a.207.1.1: Formin homology 2 domain (FH2 domain) [101448] (2 proteins)
  6. 651102Protein Bni1 [101451] (1 species)
  7. 651103Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101452] (3 PDB entries)
  8. 651107Domain d1y64b1: 1y64 B:1350-1760 [122659]
    Other proteins in same PDB: d1y64a1, d1y64a2
    automatically matched to d1ux5a_
    complexed with atp, ca

Details for d1y64b1

PDB Entry: 1y64 (more details), 3.05 Å

PDB Description: Bni1p Formin Homology 2 Domain complexed with ATP-actin
PDB Compounds: (B:) bni1 protein

SCOP Domain Sequences for d1y64b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y64b1 a.207.1.1 (B:1350-1760) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kyprphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslas
krkedlqkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskse
iievsvnlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrm
raltvvtsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgf
klstlqrltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndc
kdfsqsivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimef
eslmhtygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikh

SCOP Domain Coordinates for d1y64b1:

Click to download the PDB-style file with coordinates for d1y64b1.
(The format of our PDB-style files is described here.)

Timeline for d1y64b1: