Lineage for d1y5wa1 (1y5w A:11-382)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685691Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 685692Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 685703Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 685704Species Zymomonas mobilis [TaxId:542] [51716] (29 PDB entries)
  8. 685706Domain d1y5wa1: 1y5w A:11-382 [122654]
    automatically matched to d1q2ra_
    complexed with gol, nez, zn

Details for d1y5wa1

PDB Entry: 1y5w (more details), 1.58 Å

PDB Description: trna-guanine transglycosylase (tgt) in complex with 6-amino-4-[2-(4- methylphenyl)ethyl]-1,7-dihydro-8h-imidazo[4,5-g]quinazolin-8-one
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOP Domain Sequences for d1y5wa1:

Sequence, based on SEQRES records: (download)

>d1y5wa1 c.1.20.1 (A:11-382) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

Sequence, based on observed residues (ATOM records): (download)

>d1y5wa1 c.1.20.1 (A:11-382) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvtkqseegvtfmlspersieiqh
llgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgiqqgs
vfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmgvgkp
ddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechcavcqk
wsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfraryf

SCOP Domain Coordinates for d1y5wa1:

Click to download the PDB-style file with coordinates for d1y5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1y5wa1: