![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141879] (7 PDB entries) Uniprot P50172 24-298 |
![]() | Domain d1y5rb_: 1y5r B: [122652] automated match to d1xsea_ complexed with c0r, ndp |
PDB Entry: 1y5r (more details), 3 Å
SCOPe Domain Sequences for d1y5rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5rb_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]} eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt pillgnpgrkimeffslryynkdmf
Timeline for d1y5rb_: