SCOPe 2.08: Domain d1y5rb_: 1y5r B:

Lineage for d1y5rb_ (1y5r B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141879] (7 PDB entries)
   Uniprot P50172 24-298

8. Domain d1y5rb_: 1y5r B: [122652]
   automated match to d1xsea_
   complexed with c0r, ndp

Details for d1y5rb_

PDB Entry: 1y5r, 3 Å

PDB Description: The crystal structure of murine 11b-hydroxysteroid dehydrogenase complexed with corticosterone

PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d1y5rb_:

Sequence; same for both SEQRES and ATOM records:

>d1y5rb_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
pillgnpgrkimeffslryynkdmf

Timeline for d1y5rb_:

• d1y5rb_ first appeared in SCOP 1.73, called d1y5rb1
  
• d1y5rb_ appears in SCOPe 2.07