Lineage for d1y5ra_ (1y5r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841402Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2841524Species Mouse (Mus musculus) [TaxId:10090] [141879] (7 PDB entries)
    Uniprot P50172 24-298
  8. 2841539Domain d1y5ra_: 1y5r A: [122651]
    automated match to d1xsea_
    complexed with c0r, ndp

Details for d1y5ra_

PDB Entry: 1y5r (more details), 3 Å

PDB Description: The crystal structure of murine 11b-hydroxysteroid dehydrogenase complexed with corticosterone
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d1y5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ra_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
pillgnpgrkimeffslryynkdmf

SCOPe Domain Coordinates for d1y5ra_:

Click to download the PDB-style file with coordinates for d1y5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1y5ra_: