Lineage for d1y5oa1 (1y5o A:2-115)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673416Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 673417Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (1 species)
  7. 673418Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (2 PDB entries)
  8. 673419Domain d1y5oa1: 1y5o A:2-115 [122650]
    mutant

Details for d1y5oa1

PDB Entry: 1y5o (more details)

PDB Description: nmr structure of the amino-terminal domain from the tfb1 subunit of yeast tfiih
PDB Compounds: (A:) RNA polymerase II transcription factor B 73 kDa subunit

SCOP Domain Sequences for d1y5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5oa1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOP Domain Coordinates for d1y5oa1:

Click to download the PDB-style file with coordinates for d1y5oa1.
(The format of our PDB-style files is described here.)

Timeline for d1y5oa1: