Lineage for d1y5na2 (1y5n A:1-1074)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140594Protein Respiratory nitrate reductase 1 alpha chain [102673] (1 species)
  7. 2140595Species Escherichia coli [TaxId:562] [102674] (7 PDB entries)
    Uniprot P09152
  8. 2140603Domain d1y5na2: 1y5n A:1-1074 [122648]
    Other proteins in same PDB: d1y5na1, d1y5nb_, d1y5nc_
    automated match to d1siwa2
    complexed with 3ph, 6mo, aga, f3s, hem, md1, pci, sf4; mutant

Details for d1y5na2

PDB Entry: 1y5n (more details), 2.5 Å

PDB Description: The crystal structure of the NarGHI mutant NarI-K86A in complex with pentachlorophenol
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d1y5na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5na2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevi

SCOPe Domain Coordinates for d1y5na2:

Click to download the PDB-style file with coordinates for d1y5na2.
(The format of our PDB-style files is described here.)

Timeline for d1y5na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y5na1