Lineage for d1y5na1 (1y5n A:1075-1244)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672755Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 672778Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 672802Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 672857Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)
  7. 672858Species Escherichia coli [TaxId:562] [101829] (7 PDB entries)
  8. 672864Domain d1y5na1: 1y5n A:1075-1244 [122647]
    Other proteins in same PDB: d1y5na2, d1y5nb1
    automatically matched to d1r27a1
    complexed with 3ph, 6mo, aga, f3s, hem, md1, pci, sf4; mutant

Details for d1y5na1

PDB Entry: 1y5n (more details), 2.5 Å

PDB Description: The crystal structure of the NarGHI mutant NarI-K86A in complex with pentachlorophenol
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOP Domain Sequences for d1y5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5na1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

SCOP Domain Coordinates for d1y5na1:

Click to download the PDB-style file with coordinates for d1y5na1.
(The format of our PDB-style files is described here.)

Timeline for d1y5na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y5na2
View in 3D
Domains from other chains:
(mouse over for more information)
d1y5nb1