Lineage for d1y5ma1 (1y5m A:25-289)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1826950Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1827072Species Mouse (Mus musculus) [TaxId:10090] [141879] (5 PDB entries)
    Uniprot P50172 24-298
  8. 1827073Domain d1y5ma1: 1y5m A:25-289 [122645]
    complexed with ndp, oct, so4

Details for d1y5ma1

PDB Entry: 1y5m (more details), 2.3 Å

PDB Description: The crystal structure of murine 11b-hydroxysteroid dehydrogenase: an important therapeutic target for diabetes
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d1y5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ma1 c.2.1.2 (A:25-289) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
pillgnpgrkimeffslryynkdmf

SCOPe Domain Coordinates for d1y5ma1:

Click to download the PDB-style file with coordinates for d1y5ma1.
(The format of our PDB-style files is described here.)

Timeline for d1y5ma1: