![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102956] (7 PDB entries) Uniprot P11349 |
![]() | Domain d1y5lb1: 1y5l B:1-509 [122644] Other proteins in same PDB: d1y5la1, d1y5la2, d1y5lc1 automatically matched to d1q16b_ complexed with 3ph, 6mo, f3s, hem, md1, sf4; mutant |
PDB Entry: 1y5l (more details), 2.5 Å
SCOP Domain Sequences for d1y5lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5lb1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf gdgchgsdtkfnlfnsrridaidvtskte
Timeline for d1y5lb1: