SCOP 1.73: Domain d1y5lb1: 1y5l B:1-509

Lineage for d1y5lb1 (1y5l B:1-509)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species)

7. Species Escherichia coli [TaxId:562] [102956] (6 PDB entries)

8. Domain d1y5lb1: 1y5l B:1-509 [122644]
   Other proteins in same PDB: d1y5la1, d1y5la2
   automatically matched to d1q16b_
   complexed with 3ph, 6mo, f3s, hem, md1, sf4; mutant

Details for d1y5lb1

PDB Entry: 1y5l, 2.5 Å

PDB Description: the crystal structure of the narghi mutant nari-h66y

PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOP Domain Sequences for d1y5lb1:

Sequence; same for both SEQRES and ATOM records:

>d1y5lb1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

Timeline for d1y5lb1:

• d1y5lb1 is new in SCOP 1.73
  
• d1y5lb1 appears in SCOP 1.75
  
• d1y5lb1 appears in the current release, SCOPe 2.08, called d1y5lb_