SCOPe 2.08: Domain d1y5lb_: 1y5l B:

Lineage for d1y5lb_ (1y5l B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)

7. Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
   Uniprot P11349

8. Domain d1y5lb_: 1y5l B: [122644]
   Other proteins in same PDB: d1y5la1, d1y5la2, d1y5lc1
   automated match to d1q16b_
   complexed with 3ph, 6mo, f3s, hem, md1, sf4; mutant

Details for d1y5lb_

PDB Entry: 1y5l, 2.5 Å

PDB Description: the crystal structure of the narghi mutant nari-h66y

PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d1y5lb_:

Sequence; same for both SEQRES and ATOM records:

>d1y5lb_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

Timeline for d1y5lb_:

• d1y5lb_ first appeared in SCOP 1.73, called d1y5lb1
  
• d1y5lb_ appears in SCOPe 2.07