Lineage for d1y5la1 (1y5l A:1075-1244)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070519Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2070582Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2070613Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2070672Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)
  7. 2070673Species Escherichia coli [TaxId:562] [101829] (7 PDB entries)
    Uniprot P09152
  8. 2070680Domain d1y5la1: 1y5l A:1075-1244 [122642]
    Other proteins in same PDB: d1y5la2, d1y5lb_, d1y5lc1
    automated match to d1siwa1
    complexed with 3ph, 6mo, f3s, hem, md1, sf4; mutant

Details for d1y5la1

PDB Entry: 1y5l (more details), 2.5 Å

PDB Description: the crystal structure of the narghi mutant nari-h66y
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d1y5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5la1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

SCOPe Domain Coordinates for d1y5la1:

Click to download the PDB-style file with coordinates for d1y5la1.
(The format of our PDB-style files is described here.)

Timeline for d1y5la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y5la2