Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species) |
Species Escherichia coli [TaxId:562] [101829] (7 PDB entries) Uniprot P09152 |
Domain d1y5la1: 1y5l A:1075-1244 [122642] Other proteins in same PDB: d1y5la2, d1y5lb_, d1y5lc1 automated match to d1siwa1 complexed with 3ph, 6mo, f3s, hem, md1, sf4; mutant |
PDB Entry: 1y5l (more details), 2.5 Å
SCOPe Domain Sequences for d1y5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5la1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
Timeline for d1y5la1: