| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 protein domains) members of this "family" may be more closely related to other ferredoxins than to each other |
| Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species) |
| Species Escherichia coli [TaxId:562] [102956] (7 PDB entries) Uniprot P11349 |
| Domain d1y5ib1: 1y5i B:1-509 [122641] Other proteins in same PDB: d1y5ia1, d1y5ia2, d1y5ic1 automatically matched to d1q16b_ complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant |
| PDB Entry: 1y5i (more details) PDB Description: the crystal structure of the narghi mutant nari-k86a
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chainSCOP Domain Sequences for d1y5ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte
SCOP Domain Coordinates for d1y5ib1:
Click to download the PDB-style file with coordinates for d1y5ib1. (The format of our PDB-style files is described here.)
Timeline for d1y5ib1:
d1y5ib1 appears in SCOP 1.73 | d1y5ib1 (click for larger image) d1y5ib1 in context of chain d1y5ib1 in context of PDB Domains from other chains: d1y5ia1, d1y5ia2, d1y5ic1 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |