SCOP 1.73: Domain d1y5ec1: 1y5e C:12-166

Lineage for d1y5ec1 (1y5e C:12-166)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.1: MogA-like [53219] (5 proteins)

6. Protein MoaB [89722] (2 species)

7. Species Bacillus cereus [TaxId:1396] [142542] (1 PDB entry)

8. Domain d1y5ec1: 1y5e C:12-166 [122634]
   automatically matched to 1Y5E A:12-166
   complexed with imd, mpd

Details for d1y5ec1

PDB Entry: 1y5e, 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein B

PDB Compounds: (C:) Molybdenum cofactor biosynthesis protein B

SCOP Domain Sequences for d1y5ec1:

Sequence; same for both SEQRES and ATOM records:

>d1y5ec1 c.57.1.1 (C:12-166) MoaB {Bacillus cereus [TaxId: 1396]}
kevrckivtisdtrteetdksgqllhellkeaghkvtsyeivkddkesiqqavlagyhke
dvdvvltnggtgitkrdvtieavsalldkeivgfgelfrmisyledigssamlsraiggt
igrkvvfsmpgssgavrlamnklilpelghitfel

Timeline for d1y5ec1:

• d1y5ec1 is new in SCOP 1.73
  
• d1y5ec1 appears in SCOP 1.75
  
• d1y5ec1 appears in the current release, SCOPe 2.08, called d1y5ec_