SCOP 1.73: Domain d1y4zc1: 1y4z C:1-225

Lineage for d1y4zc1 (1y4z C:1-225)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family)
   possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC

5. Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (1 protein)

6. Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)

7. Species Escherichia coli [TaxId:562] [103504] (3 PDB entries)

8. Domain d1y4zc1: 1y4z C:1-225 [122631]
   Other proteins in same PDB: d1y4za1, d1y4za2
   automatically matched to d1q16c_
   complexed with 6mo, aga, f3s, hem, md1, pci, sf4; mutant

Details for d1y4zc1

PDB Entry: 1y4z, 2 Å

PDB Description: the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol

PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOP Domain Sequences for d1y4zc1:

Sequence, based on SEQRES records:

>d1y4zc1 f.21.3.1 (C:1-225) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records):

>d1y4zc1 f.21.3.1 (C:1-225) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil
ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl
vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Timeline for d1y4zc1:

• d1y4zc1 is new in SCOP 1.73
  
• d1y4zc1 appears in SCOP 1.75
  
• d1y4zc1 appears in the current release, SCOPe 2.08, called d1y4zc_