SCOPe 2.03: Domain d1y4za1: 1y4z A:1075-1244

Lineage for d1y4za1 (1y4z A:1075-1244)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)

7. Species Escherichia coli [TaxId:562] [101829] (7 PDB entries)
   Uniprot P09152

8. Domain d1y4za1: 1y4z A:1075-1244 [122629]
   Other proteins in same PDB: d1y4za2, d1y4zb1, d1y4zc_
   automated match to d1siwa1
   complexed with 6mo, aga, f3s, hem, md1, pci, sf4

Details for d1y4za1

PDB Entry: 1y4z, 2 Å

PDB Description: the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol

PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d1y4za1:

Sequence; same for both SEQRES and ATOM records:

>d1y4za1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

Timeline for d1y4za1:

• d1y4za1 first appeared in SCOP 1.73
  
• d1y4za1 appears in SCOPe 2.02
  
• d1y4za1 appears in SCOPe 2.04
  
• d1y4za1 appears in the current release, SCOPe 2.08