![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (3 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
![]() | Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101829] (7 PDB entries) Uniprot P09152 |
![]() | Domain d1y4za1: 1y4z A:1075-1244 [122629] Other proteins in same PDB: d1y4za2, d1y4zb1, d1y4zc1 automatically matched to d1r27a1 complexed with 6mo, aga, f3s, hem, md1, pci, sf4; mutant |
PDB Entry: 1y4z (more details), 2 Å
SCOP Domain Sequences for d1y4za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4za1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
Timeline for d1y4za1: