SCOP 1.73: Domain d1y4mc1: 1y4m C:46-98

Lineage for d1y4mc1 (1y4m C:46-98)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (8 proteins)

6. Protein HERV-FRD_6p24.1 provirus ancestral Env polyprotein [144288] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144289] (1 PDB entry)

8. Domain d1y4mc1: 1y4m C:46-98 [122628]
   automatically matched to 1Y4M A:46-98

Details for d1y4mc1

PDB Entry: 1y4m, 1.6 Å

PDB Description: Crystal structure of human endogenous retrovirus HERV-FRD envelope protein (syncitin-2)

PDB Compounds: (C:) HERV-FRD_6p24.1 provirus ancestral Env polyprotein

SCOP Domain Sequences for d1y4mc1:

Sequence; same for both SEQRES and ATOM records:

>d1y4mc1 h.3.2.1 (C:46-98) HERV-FRD_6p24.1 provirus ancestral Env polyprotein {Human (Homo sapiens) [TaxId: 9606]}
nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn

Timeline for d1y4mc1:

• d1y4mc1 is new in SCOP 1.73
  
• d1y4mc1 appears in SCOP 1.75
  
• d1y4mc1 appears in the current release, SCOPe 2.08, called d1y4mc_