Lineage for d1y4mb_ (1y4m B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042069Protein HERV-FRD_6p24.1 provirus ancestral Env polyprotein [144288] (1 species)
  7. 3042070Species Human (Homo sapiens) [TaxId:9606] [144289] (1 PDB entry)
    Uniprot P60508 391-443
  8. 3042072Domain d1y4mb_: 1y4m B: [122627]
    automated match to d1y4ma1
    complexed with cl

Details for d1y4mb_

PDB Entry: 1y4m (more details), 1.6 Å

PDB Description: Crystal structure of human endogenous retrovirus HERV-FRD envelope protein (syncitin-2)
PDB Compounds: (B:) HERV-FRD_6p24.1 provirus ancestral Env polyprotein

SCOPe Domain Sequences for d1y4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4mb_ h.3.2.1 (B:) HERV-FRD_6p24.1 provirus ancestral Env polyprotein {Human (Homo sapiens) [TaxId: 9606]}
nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn

SCOPe Domain Coordinates for d1y4mb_:

Click to download the PDB-style file with coordinates for d1y4mb_.
(The format of our PDB-style files is described here.)

Timeline for d1y4mb_: