SCOP 1.73: Domain d1y4la1: 1y4l A:1-133

Lineage for d1y4la1 (1y4l A:1-133)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Terciopelo (Bothrops asper), myotoxin I [TaxId:8722] [48644] (2 PDB entries)

8. Domain d1y4la1: 1y4l A:1-133 [122624]
   automatically matched to d1clpa_
   complexed with ipa, p33, svr

Details for d1y4la1

PDB Entry: 1y4l, 1.7 Å

PDB Description: crystal structure of bothrops asper myotoxin ii complexed with the anti-trypanosomal drug suramin

PDB Compounds: (A:) Phospholipase A2 homolog 2

SCOP Domain Sequences for d1y4la1:

Sequence; same for both SEQRES and ATOM records:

>d1y4la1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Terciopelo (Bothrops asper), myotoxin I [TaxId: 8722]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c

Timeline for d1y4la1:

• d1y4la1 is new in SCOP 1.73
  
• d1y4la1 appears in SCOP 1.75
  
• d1y4la1 appears in the current release, SCOPe 2.08, called d1y4la_