SCOPe 2.08: Domain d1y4la_: 1y4l A:

Lineage for d1y4la_ (1y4l A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Terciopelo (Bothrops asper), myotoxin I [TaxId:8722] [48644] (2 PDB entries)

8. Domain d1y4la_: 1y4l A: [122624]
   automated match to d1clpa_
   complexed with ipa, p33, svr

Details for d1y4la_

PDB Entry: 1y4l, 1.7 Å

PDB Description: crystal structure of bothrops asper myotoxin ii complexed with the anti-trypanosomal drug suramin

PDB Compounds: (A:) Phospholipase A2 homolog 2

SCOPe Domain Sequences for d1y4la_:

Sequence; same for both SEQRES and ATOM records:

>d1y4la_ a.133.1.2 (A:) Snake phospholipase A2 {Terciopelo (Bothrops asper), myotoxin I [TaxId: 8722]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c

Timeline for d1y4la_:

• d1y4la_ first appeared in SCOP 1.73, called d1y4la1
  
• d1y4la_ appears in SCOPe 2.07