![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Snake phospholipase A2 [48624] (38 species) |
![]() | Species Terciopelo (Bothrops asper), myotoxin I [TaxId:8722] [48644] (2 PDB entries) |
![]() | Domain d1y4la_: 1y4l A: [122624] automated match to d1clpa_ complexed with ipa, p33, svr |
PDB Entry: 1y4l (more details), 1.7 Å
SCOPe Domain Sequences for d1y4la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4la_ a.133.1.2 (A:) Snake phospholipase A2 {Terciopelo (Bothrops asper), myotoxin I [TaxId: 8722]} slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada c
Timeline for d1y4la_: