SCOP 1.73: Domain d1y4ka2: 1y4k A:6-149

Lineage for d1y4ka2 (1y4k A:6-149)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (9 PDB entries)

8. Domain d1y4ka2: 1y4k A:6-149 [122623]
   Other proteins in same PDB: d1y4ka1
   automatically matched to d1yge_2
   complexed with act, edo, fe2; mutant

Details for d1y4ka2

PDB Entry: 1y4k, 1.95 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, n694g mutant

PDB Compounds: (A:) seed lipoxygenase-1

SCOP Domain Sequences for d1y4ka2:

Sequence, based on SEQRES records:

>d1y4ka2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d1y4ka2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
esafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvr
iffanhty

Timeline for d1y4ka2:

• d1y4ka2 is new in SCOP 1.73
  
• d1y4ka2 appears in SCOP 1.75
  
• d1y4ka2 appears in the current release, SCOPe 2.08