![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
![]() | Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
![]() | Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) |
![]() | Protein Plant lipoxigenase [49725] (2 species) |
![]() | Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries) |
![]() | Domain d1y4ka2: 1y4k A:6-149 [122623] Other proteins in same PDB: d1y4ka1 automated match to d1ygea2 complexed with act, edo, fe2; mutant |
PDB Entry: 1y4k (more details), 1.95 Å
SCOPe Domain Sequences for d1y4ka2:
Sequence, based on SEQRES records: (download)
>d1y4ka2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]} hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf vcnswvyntklyksvriffanhty
>d1y4ka2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]} hkikgtvvlmpknnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag esafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvr iffanhty
Timeline for d1y4ka2: