![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) ![]() |
![]() | Family b.61.2.2: Staphostatin [101869] (2 proteins) cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand |
![]() | Protein Staphostatin B (SspC) [101872] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries) |
![]() | Domain d1y4hd_: 1y4h D: [122618] Other proteins in same PDB: d1y4ha1, d1y4hb_ automated match to d1nyca_ complexed with cl, so4 |
PDB Entry: 1y4h (more details), 1.93 Å
SCOPe Domain Sequences for d1y4hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4hd_ b.61.2.2 (D:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]} myqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfidt ahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
Timeline for d1y4hd_: