SCOPe 2.04: Domain d1y4hc_: 1y4h C:

Lineage for d1y4hc_ (1y4h C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families)

5. Family b.61.2.2: Staphostatin [101869] (2 proteins)
   cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand

6. Protein Staphostatin B (SspC) [101872] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)

8. Domain d1y4hc_: 1y4h C: [122617]
   Other proteins in same PDB: d1y4ha1, d1y4hb_
   automated match to d1nyca_
   complexed with cl, so4

Details for d1y4hc_

PDB Entry: 1y4h, 1.93 Å

PDB Description: wild type staphopain-staphostatin complex

PDB Compounds: (C:) cysteine protease Inhibitor

SCOPe Domain Sequences for d1y4hc_:

Sequence; same for both SEQRES and ATOM records:

>d1y4hc_ b.61.2.2 (C:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
myqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfidt
ahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

Timeline for d1y4hc_:

• d1y4hc_ first appeared in SCOP 1.73, called d1y4hc1
  
• d1y4hc_ appears in SCOPe 2.03
  
• d1y4hc_ appears in SCOPe 2.05
  
• d1y4hc_ appears in the current release, SCOPe 2.08