Lineage for d1y4ha1 (1y4h A:221-393)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2173269Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2173590Protein Staphopain SspB [102721] (1 species)
  7. 2173591Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
    Uniprot Q70UQ9 41-393
  8. 2173594Domain d1y4ha1: 1y4h A:221-393 [122615]
    Other proteins in same PDB: d1y4hc_, d1y4hd_
    complexed with cl, so4

Details for d1y4ha1

PDB Entry: 1y4h (more details), 1.93 Å

PDB Description: wild type staphopain-staphostatin complex
PDB Compounds: (A:) Cysteine protease

SCOPe Domain Sequences for d1y4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4ha1 d.3.1.1 (A:221-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
qvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlp
ncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlgh
alavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy

SCOPe Domain Coordinates for d1y4ha1:

Click to download the PDB-style file with coordinates for d1y4ha1.
(The format of our PDB-style files is described here.)

Timeline for d1y4ha1: