SCOPe 2.07: Domain d1y47a1: 1y47 A:1-46

Lineage for d1y47a1 (1y47 A:1-46)

1. Root: SCOPe 2.07

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)

4. Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family)

5. Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
   this is not a true family

6. Protein Artificial diiron protein [58837] (1 species)
   dimeric alpha-hairpin fold

7. Species Synthetic, different variants [58838] (12 PDB entries)

8. Domain d1y47a1: 1y47 A:1-46 [122610]
   automatically matched to 1U7J A:1-49
   complexed with cd

Details for d1y47a1

PDB Entry: 1y47, 2.7 Å

PDB Description: Structural studies of designed alpha-helical hairpins

PDB Compounds: (A:) dueferri (DF2)

SCOPe Domain Sequences for d1y47a1:

Sequence; same for both SEQRES and ATOM records:

>d1y47a1 k.8.1.1 (A:1-46) Artificial diiron protein {Synthetic, different variants}
dylrelykleqqamklyreaservgdpvlakiledeekhiewleti

Timeline for d1y47a1:

• d1y47a1 first appeared in SCOP 1.73
  
• d1y47a1 appears in SCOPe 2.06
  
• d1y47a1 appears in the current release, SCOPe 2.08