Lineage for d1y47a1 (1y47 A:1-46)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3047948Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 3047949Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 3047950Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 3047951Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 3047952Species Synthetic, different variants [58838] (12 PDB entries)
  8. 3047970Domain d1y47a1: 1y47 A:1-46 [122610]
    automatically matched to 1U7J A:1-49
    complexed with cd

Details for d1y47a1

PDB Entry: 1y47 (more details), 2.7 Å

PDB Description: Structural studies of designed alpha-helical hairpins
PDB Compounds: (A:) dueferri (DF2)

SCOPe Domain Sequences for d1y47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y47a1 k.8.1.1 (A:1-46) Artificial diiron protein {Synthetic, different variants}
dylrelykleqqamklyreaservgdpvlakiledeekhiewleti

SCOPe Domain Coordinates for d1y47a1:

Click to download the PDB-style file with coordinates for d1y47a1.
(The format of our PDB-style files is described here.)

Timeline for d1y47a1:

3047970
d1y47a1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1y47b1