![]() | Class k: Designed proteins [58788] (44 folds) |
![]() | Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily) |
![]() | Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) ![]() |
![]() | Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins) this is not a true family |
![]() | Protein Artificial diiron protein [58837] (1 species) dimeric alpha-hairpin fold |
![]() | Species Synthetic, different variants [58838] (12 PDB entries) |
![]() | Domain d1y47a1: 1y47 A:1-46 [122610] automatically matched to 1U7J A:1-49 complexed with cd |
PDB Entry: 1y47 (more details), 2.7 Å
SCOPe Domain Sequences for d1y47a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y47a1 k.8.1.1 (A:1-46) Artificial diiron protein {Synthetic, different variants} dylrelykleqqamklyreaservgdpvlakiledeekhiewleti
Timeline for d1y47a1: