Lineage for d1y44b_ (1y44 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937968Family d.157.1.7: RNase Z-like [143916] (1 protein)
    part of Pfam PF00753; tRNA 3'-endonuclease; elaborated with additional structures and insert alpha(2)-beta(2) subdomain
  6. 1937969Protein Ribonuclease Z (RNase Z) [143917] (3 species)
  7. 1937970Species Bacillus subtilis [TaxId:1423] [143918] (2 PDB entries)
    Uniprot P54548 1-307
  8. 1937972Domain d1y44b_: 1y44 B: [122609]
    automated match to d1y44a1
    complexed with gol, mes, po4, zn

Details for d1y44b_

PDB Entry: 1y44 (more details), 2.1 Å

PDB Description: crystal structure of rnase z
PDB Compounds: (B:) ribonuclease z

SCOPe Domain Sequences for d1y44b_:

Sequence, based on SEQRES records: (download)

>d1y44b_ d.157.1.7 (B:) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]}
mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
ithmhgdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk
laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl
evnvprg

Sequence, based on observed residues (ATOM records): (download)

>d1y44b_ d.157.1.7 (B:) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]}
mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
ithmhgdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakhstt
eqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydflevnvprg

SCOPe Domain Coordinates for d1y44b_:

Click to download the PDB-style file with coordinates for d1y44b_.
(The format of our PDB-style files is described here.)

Timeline for d1y44b_: