![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.20: Peptidase A4 [101656] (3 proteins) circular permutation of the canonical fold |
![]() | Protein Aspergillopepsin II [141152] (1 species) |
![]() | Species Aspergillus niger [TaxId:5061] [141153] (1 PDB entry) Uniprot P24665 60-91,112-282 |
![]() | Domain d1y43.1: 1y43 A:1-32,B:3-173 [122607] complexed with so4 |
PDB Entry: 1y43 (more details), 1.4 Å
SCOPe Domain Sequences for d1y43.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1y43.1 b.29.1.20 (A:1-32,B:3-173) Aspergillopepsin II {Aspergillus niger [TaxId: 5061]} eeyssnwagavligdgytkvtgeftvpsvsagXeeycasawvgidgdtcetailqtgvdf cyedgqtsydawyewypdyaydfsditisegdsikvtveatskssgsatvenlttgqsvt htfsgnvegdlcetnaewivedfesgdslvafadfgsvtftnaeatsggstvgpsdatvm dieqdgsvltetsvsgdsvtvtyv
Timeline for d1y43.1: