Lineage for d1y43.1 (1y43 A:1-32,B:3-173)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780498Family b.29.1.20: Peptidase A4 [101656] (3 proteins)
    circular permutation of the canonical fold
  6. 2780499Protein Aspergillopepsin II [141152] (1 species)
  7. 2780500Species Aspergillus niger [TaxId:5061] [141153] (1 PDB entry)
    Uniprot P24665 60-91,112-282
  8. 2780501Domain d1y43.1: 1y43 A:1-32,B:3-173 [122607]
    complexed with so4

Details for d1y43.1

PDB Entry: 1y43 (more details), 1.4 Å

PDB Description: crystal structure of aspergilloglutamic peptidase from Aspergillus niger
PDB Compounds: (A:) Aspergillopepsin II light chain, (B:) Aspergillopepsin II heavy chain

SCOPe Domain Sequences for d1y43.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1y43.1 b.29.1.20 (A:1-32,B:3-173) Aspergillopepsin II {Aspergillus niger [TaxId: 5061]}
eeyssnwagavligdgytkvtgeftvpsvsagXeeycasawvgidgdtcetailqtgvdf
cyedgqtsydawyewypdyaydfsditisegdsikvtveatskssgsatvenlttgqsvt
htfsgnvegdlcetnaewivedfesgdslvafadfgsvtftnaeatsggstvgpsdatvm
dieqdgsvltetsvsgdsvtvtyv

SCOPe Domain Coordinates for d1y43.1:

Click to download the PDB-style file with coordinates for d1y43.1.
(The format of our PDB-style files is described here.)

Timeline for d1y43.1: