SCOPe 2.08: Domain d1y3ua_: 1y3u A:

Lineage for d1y3ua_ (1y3u A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
   Uniprot P00760

8. Domain d1y3ua_: 1y3u A: [122602]
   automated match to d1aq7__
   complexed with ca, uiq

Details for d1y3ua_

PDB Entry: 1y3u, 1.8 Å

PDB Description: trypsin inhibitor complex

PDB Compounds: (A:) Trypsin, cationic

SCOPe Domain Sequences for d1y3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1y3ua_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1y3ua_:

• d1y3ua_ first appeared in SCOP 1.73, called d1y3ua1
  
• d1y3ua_ appears in SCOPe 2.07