SCOP 1.73: Domain d1y3tb1: 1y3t B:5-334

Lineage for d1y3tb1 (1y3t B:5-334)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Hypothetical protein YxaG [141597] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141598] (1 PDB entry)

8. Domain d1y3tb1: 1y3t B:5-334 [122601]
   automatically matched to 1Y3T A:5-334
   complexed with fe

Details for d1y3tb1

PDB Entry: 1y3t, 2.4 Å

PDB Description: Crystal structure of YxaG, a dioxygenase from Bacillus subtilis

PDB Compounds: (B:) Hypothetical protein yxaG

SCOP Domain Sequences for d1y3tb1:

Sequence; same for both SEQRES and ATOM records:

>d1y3tb1 b.82.1.5 (B:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}
cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh
kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva
hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg
avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy
clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd
pyeghifpckpqalrfdrilqniealdlkv

Timeline for d1y3tb1:

• d1y3tb1 is new in SCOP 1.73
  
• d1y3tb1 appears in SCOP 1.75
  
• d1y3tb1 appears in the current release, SCOPe 2.08, called d1y3tb_