Lineage for d1y3tb1 (1y3t B:5-334)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677446Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (2 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 677447Protein Hypothetical protein YxaG [141597] (1 species)
  7. 677448Species Bacillus subtilis [TaxId:1423] [141598] (1 PDB entry)
  8. 677450Domain d1y3tb1: 1y3t B:5-334 [122601]
    automatically matched to 1Y3T A:5-334
    complexed with fe

Details for d1y3tb1

PDB Entry: 1y3t (more details), 2.4 Å

PDB Description: Crystal structure of YxaG, a dioxygenase from Bacillus subtilis
PDB Compounds: (B:) Hypothetical protein yxaG

SCOP Domain Sequences for d1y3tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3tb1 b.82.1.5 (B:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}
cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh
kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva
hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg
avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy
clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd
pyeghifpckpqalrfdrilqniealdlkv

SCOP Domain Coordinates for d1y3tb1:

Click to download the PDB-style file with coordinates for d1y3tb1.
(The format of our PDB-style files is described here.)

Timeline for d1y3tb1: