Lineage for d1y3ta1 (1y3t A:5-334)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814717Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2814718Protein Hypothetical protein YxaG [141597] (1 species)
  7. 2814719Species Bacillus subtilis [TaxId:1423] [141598] (1 PDB entry)
    Uniprot P42106 5-334
  8. 2814720Domain d1y3ta1: 1y3t A:5-334 [122600]
    complexed with fe

Details for d1y3ta1

PDB Entry: 1y3t (more details), 2.4 Å

PDB Description: Crystal structure of YxaG, a dioxygenase from Bacillus subtilis
PDB Compounds: (A:) Hypothetical protein yxaG

SCOPe Domain Sequences for d1y3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}
cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh
kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva
hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg
avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy
clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd
pyeghifpckpqalrfdrilqniealdlkv

SCOPe Domain Coordinates for d1y3ta1:

Click to download the PDB-style file with coordinates for d1y3ta1.
(The format of our PDB-style files is described here.)

Timeline for d1y3ta1: