Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (10 species) not a true protein |
Species Sphingomonas sp. [TaxId:90322] [186866] (5 PDB entries) |
Domain d1y3qa_: 1y3q A: [122599] automated match to d1j1na_ complexed with ca |
PDB Entry: 1y3q (more details), 1.9 Å
SCOPe Domain Sequences for d1y3qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y3qa_ c.94.1.1 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]} reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi vmqkaydrqy
Timeline for d1y3qa_: