Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Alginate-binding periplasmic protein AlgQ1 [142808] (1 species) |
Species Sphingomonas sp. [TaxId:28214] [142809] (3 PDB entries) Uniprot Q9KWT6 25-514 |
Domain d1y3qa1: 1y3q A:1-490 [122599] automatically matched to 1Y3N A:1-490 complexed with ca |
PDB Entry: 1y3q (more details), 1.9 Å
SCOP Domain Sequences for d1y3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y3qa1 c.94.1.1 (A:1-490) Alginate-binding periplasmic protein AlgQ1 {Sphingomonas sp. [TaxId: 28214]} reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi vmqkaydrqy
Timeline for d1y3qa1: