Lineage for d1y3qa_ (1y3q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145345Species Sphingomonas sp. [TaxId:90322] [186866] (5 PDB entries)
  8. 2145348Domain d1y3qa_: 1y3q A: [122599]
    automated match to d1j1na_
    complexed with ca

Details for d1y3qa_

PDB Entry: 1y3q (more details), 1.9 Å

PDB Description: Structure of AlgQ1, alginate-binding protein
PDB Compounds: (A:) AlgQ1

SCOPe Domain Sequences for d1y3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3qa_ c.94.1.1 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl
mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap
dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade
ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke
glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk
gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk
pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq
ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi
vmqkaydrqy

SCOPe Domain Coordinates for d1y3qa_:

Click to download the PDB-style file with coordinates for d1y3qa_.
(The format of our PDB-style files is described here.)

Timeline for d1y3qa_: