Lineage for d1y3pa_ (1y3p A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009382Species Sphingomonas sp. [TaxId:90322] [186866] (5 PDB entries)
  8. 1009388Domain d1y3pa_: 1y3p A: [122598]
    automated match to d1j1na_
    complexed with ca

Details for d1y3pa_

PDB Entry: 1y3p (more details), 2 Å

PDB Description: structure of algq1, alginate-binding protein, complexed with an alginate tetrasaccharide
PDB Compounds: (A:) AlgQ1

SCOPe Domain Sequences for d1y3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3pa_ c.94.1.1 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl
mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap
dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade
ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke
glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk
gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk
pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq
ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi
vmqkaydrqy

SCOPe Domain Coordinates for d1y3pa_:

Click to download the PDB-style file with coordinates for d1y3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1y3pa_: