Lineage for d1y3pa1 (1y3p A:1-490)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846204Protein Alginate-binding periplasmic protein AlgQ1 [142808] (1 species)
  7. 846205Species Sphingomonas sp. [TaxId:28214] [142809] (3 PDB entries)
    Uniprot Q9KWT6 25-514
  8. 846208Domain d1y3pa1: 1y3p A:1-490 [122598]
    automatically matched to 1Y3N A:1-490
    complexed with ca, lgu, mav, maw

Details for d1y3pa1

PDB Entry: 1y3p (more details), 2 Å

PDB Description: structure of algq1, alginate-binding protein, complexed with an alginate tetrasaccharide
PDB Compounds: (A:) AlgQ1

SCOP Domain Sequences for d1y3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3pa1 c.94.1.1 (A:1-490) Alginate-binding periplasmic protein AlgQ1 {Sphingomonas sp. [TaxId: 28214]}
reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl
mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap
dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade
ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke
glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk
gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk
pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq
ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi
vmqkaydrqy

SCOP Domain Coordinates for d1y3pa1:

Click to download the PDB-style file with coordinates for d1y3pa1.
(The format of our PDB-style files is described here.)

Timeline for d1y3pa1: