SCOP 1.75: Domain d1y3pa1: 1y3p A:1-490

Lineage for d1y3pa1 (1y3p A:1-490)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Alginate-binding periplasmic protein AlgQ1 [142808] (1 species)

7. Species Sphingomonas sp. [TaxId:28214] [142809] (3 PDB entries)
   Uniprot Q9KWT6 25-514

8. Domain d1y3pa1: 1y3p A:1-490 [122598]
   automatically matched to 1Y3N A:1-490
   complexed with ca, lgu, mav, maw

Details for d1y3pa1

PDB Entry: 1y3p, 2 Å

PDB Description: structure of algq1, alginate-binding protein, complexed with an alginate tetrasaccharide

PDB Compounds: (A:) AlgQ1

SCOP Domain Sequences for d1y3pa1:

Sequence; same for both SEQRES and ATOM records:

>d1y3pa1 c.94.1.1 (A:1-490) Alginate-binding periplasmic protein AlgQ1 {Sphingomonas sp. [TaxId: 28214]}
reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl
mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap
dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade
ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke
glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk
gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk
pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq
ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi
vmqkaydrqy

Timeline for d1y3pa1:

• d1y3pa1 first appeared in SCOP 1.73
  
• d1y3pa1 is called d1y3pa_ in SCOPe 2.01
  
• d1y3pa1 appears in the current release, SCOPe 2.08, called d1y3pa_