Lineage for d1y3aa2 (1y3a A:34-60,A:182-345)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696366Protein Transducin (alpha subunit) [52623] (3 species)
    common fold is interrupted with an all-alpha domain
  7. 696393Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries)
  8. 696410Domain d1y3aa2: 1y3a A:34-60,A:182-345 [122583]
    Other proteins in same PDB: d1y3aa1, d1y3ab1, d1y3ac1, d1y3ad1
    automatically matched to d1kjya2
    complexed with gdp

Details for d1y3aa2

PDB Entry: 1y3a (more details), 2.5 Å

PDB Description: Structure of G-Alpha-I1 bound to a GDP-selective peptide provides insight into guanine nucleotide exchange
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d1y3aa2:

Sequence, based on SEQRES records: (download)

>d1y3aa2 c.37.1.8 (A:34-60,A:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdviik

Sequence, based on observed residues (ATOM records): (download)

>d1y3aa2 c.37.1.8 (A:34-60,A:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvmnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekik
ksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdav
tdviik

SCOP Domain Coordinates for d1y3aa2:

Click to download the PDB-style file with coordinates for d1y3aa2.
(The format of our PDB-style files is described here.)

Timeline for d1y3aa2: