Lineage for d1y38b_ (1y38 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein automated matches [190139] (27 species)
    not a true protein
  7. Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)
  8. Domain d1y38b_: 1y38 B: [122581]
    automated match to d1tgma_
    complexed with g3p, na, pge, so4

Details for d1y38b_

PDB Entry: 1y38 (more details), 2.44 Å

PDB Description: Crystal structure of the complex formed between phospholipase A2 dimer and glycerophosphate at 2.4 A resolution
PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1y38b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y38b_ a.133.1.2 (B:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1y38b_ are not available.

Timeline for d1y38b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y38a_