SCOP 1.75: Domain d1y30a1: 1y30 A:5-147

Lineage for d1y30a1 (1y30 A:5-147)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (4 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Hypothetical protein Rv1155 [117230] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
   Uniprot O06553

8. Domain d1y30a1: 1y30 A:5-147 [122576]
   complexed with fmn

Details for d1y30a1

PDB Entry: 1y30, 2.2 Å

PDB Description: x-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'- phosphate oxidase complexed with flavin mononucleotide at 2.2 a resolution

PDB Compounds: (A:) hypothetical protein Rv1155

SCOP Domain Sequences for d1y30a1:

Sequence; same for both SEQRES and ATOM records:

>d1y30a1 b.45.1.1 (A:5-147) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

Timeline for d1y30a1:

• d1y30a1 first appeared in SCOP 1.73
  
• d1y30a1 appears in SCOPe 2.01
  
• d1y30a1 appears in the current release, SCOPe 2.08