Lineage for d1y2ya1 (1y2y A:2-58)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464902Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 1464903Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 1464904Protein H/aca ribonucleoprotein complex subunit 3 [144212] (1 species)
    lacks the zinc-binding site, mostly unstructured
  7. 1464905Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144213] (3 PDB entries)
    Uniprot Q6Q547 2-58
  8. 1464908Domain d1y2ya1: 1y2y A:2-58 [122575]
    automatically matched to 2AQA A:2-58

Details for d1y2ya1

PDB Entry: 1y2y (more details)

PDB Description: structural characterization of nop10p using nuclear magnetic resonance spectroscopy
PDB Compounds: (A:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d1y2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ya1 g.41.16.1 (A:2-58) H/aca ribonucleoprotein complex subunit 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtlkkrfglvpgq

SCOPe Domain Coordinates for d1y2ya1:

Click to download the PDB-style file with coordinates for d1y2ya1.
(The format of our PDB-style files is described here.)

Timeline for d1y2ya1: