Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) automatically mapped to Pfam PF04135 |
Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins) Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204) |
Protein H/aca ribonucleoprotein complex subunit 3 [144212] (1 species) lacks the zinc-binding site, mostly unstructured |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144213] (4 PDB entries) Uniprot Q6Q547 2-58 |
Domain d1y2ya_: 1y2y A: [122575] automated match to d2aqaa1 |
PDB Entry: 1y2y (more details)
SCOPe Domain Sequences for d1y2ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2ya_ g.41.16.1 (A:) H/aca ribonucleoprotein complex subunit 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtlkkrfglvpgq
Timeline for d1y2ya_: