Lineage for d1y2jb1 (1y2j B:163-485)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651168Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 651201Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 651202Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries)
  8. 651252Domain d1y2jb1: 1y2j B:163-485 [122570]
    automatically matched to d1mkda_
    complexed with 7de, mg, zn

Details for d1y2jb1

PDB Entry: 1y2j (more details), 2.55 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With 3,5-dimethyl-1-(3-nitro-phenyl)-1H-pyrazole-4-carboxylic acid ethyl ester
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOP Domain Sequences for d1y2jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2jb1 a.211.1.2 (B:163-485) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

SCOP Domain Coordinates for d1y2jb1:

Click to download the PDB-style file with coordinates for d1y2jb1.
(The format of our PDB-style files is described here.)

Timeline for d1y2jb1:

Domains from other chains:
(mouse over for more information)
d1y2ja1