Lineage for d1y2ga_ (1y2g A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040804Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
  5. 1040805Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 1040817Protein automated matches [190138] (1 species)
    not a true protein
  7. 1040818Species Escherichia coli [TaxId:562] [186864] (2 PDB entries)
  8. 1040819Domain d1y2ga_: 1y2g A: [122565]
    automated match to d1f7wa_
    complexed with cl3

Details for d1y2ga_

PDB Entry: 1y2g (more details), 1.9 Å

PDB Description: Crystal STructure of ZipA in complex with an inhibitor
PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1y2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ga_ d.129.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkda

SCOPe Domain Coordinates for d1y2ga_:

Click to download the PDB-style file with coordinates for d1y2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1y2ga_: