Lineage for d1y2ga1 (1y2g A:6-142)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733637Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
  5. 733638Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)
  6. 733639Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 733640Species Escherichia coli [TaxId:562] [64386] (8 PDB entries)
  8. 733644Domain d1y2ga1: 1y2g A:6-142 [122565]
    automatically matched to d1f7wa_
    complexed with cl3

Details for d1y2ga1

PDB Entry: 1y2g (more details), 1.9 Å

PDB Description: Crystal STructure of ZipA in complex with an inhibitor
PDB Compounds: (A:) cell division protein zipa

SCOP Domain Sequences for d1y2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ga1 d.129.4.1 (A:6-142) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkda

SCOP Domain Coordinates for d1y2ga1:

Click to download the PDB-style file with coordinates for d1y2ga1.
(The format of our PDB-style files is described here.)

Timeline for d1y2ga1: