SCOPe 2.01: Domain d1y2fa_: 1y2f A:

Lineage for d1y2fa_ (1y2f A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)

6. Protein automated matches [190138] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186864] (2 PDB entries)

8. Domain d1y2fa_: 1y2f A: [122564]
   automated match to d1f7wa_
   complexed with wai

Details for d1y2fa_

PDB Entry: 1y2f, 2 Å

PDB Description: Crystal Structure of ZipA with an inhibitor

PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1y2fa_:

Sequence; same for both SEQRES and ATOM records:

>d1y2fa_ d.129.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

Timeline for d1y2fa_:

• d1y2fa_ first appeared in SCOP 1.73, called d1y2fa1
  
• d1y2fa_ was called d1y2fa1 in SCOP 1.75
  
• d1y2fa_ appears in SCOPe 2.02
  
• d1y2fa_ appears in the current release, SCOPe 2.08