Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) contains a single copy of this fold |
Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins) |
Protein automated matches [190138] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [186864] (2 PDB entries) |
Domain d1y2fa_: 1y2f A: [122564] automated match to d1f7wa_ complexed with wai |
PDB Entry: 1y2f (more details), 2 Å
SCOPe Domain Sequences for d1y2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2fa_ d.129.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]} rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt pqklreyqdiirevkdana
Timeline for d1y2fa_: