Lineage for d1y2fa_ (1y2f A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976179Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 2976180Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 2976192Protein automated matches [190138] (1 species)
    not a true protein
  7. 2976193Species Escherichia coli [TaxId:562] [186864] (2 PDB entries)
  8. 2976196Domain d1y2fa_: 1y2f A: [122564]
    automated match to d1f7wa_
    complexed with wai

Details for d1y2fa_

PDB Entry: 1y2f (more details), 2 Å

PDB Description: Crystal Structure of ZipA with an inhibitor
PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1y2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2fa_ d.129.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

SCOPe Domain Coordinates for d1y2fa_:

Click to download the PDB-style file with coordinates for d1y2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1y2fa_: